TOXGO SAG2(P22), His tag
SKU: 8481042151

TOXGO SAG2(P22), His tag

Sale price$63.00 Regular price$70.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TOXGO SAG2(P22), His tagProduct Specification Species TOXGO Synonyms Surface antigen P22 Accession Q9NBH0 Amino Acid Sequence Protein sequence(Q9NBH0, Ser27 Val187, with C 10*His) STTETPAPIECTAGATKTVEAPSSGSVVFQCGDKLTISPSGEGDVFYGKECTDSRKLTTVLPGAVLKAKVEQPPKGPATYTLSYDGTPEKPQVLCYKCVAEAGAPAGRNNDGGSSAPTPKDCKLIVRVPGADGRVTSGFDPVSLTGKVLAPGLAGLLITFVGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 18. 0kDa Actual: 21kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag

Product Specification


Species TOXGO
Synonyms Surface antigen P22
Accession Q9NBH0
Amino Acid Sequence

Protein sequence(Q9NBH0, Ser27-Val187, with C-10*His) STTETPAPIECTAGATKTVEAPSSGSVVFQCGDKLTISPSGEGDVFYGKECTDSRKLTTVLPGAVLKAKVEQPPKGPATYTLSYDGTPEKPQVLCYKCVAEAGAPAGRNNDGGSSAPTPKDCKLIVRVPGADGRVTSGFDPVSLTGKVLAPGLAGLLITFVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:18.0kDa Actual:21kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Toxoplasmosis is a parasitic disease caused by Toxoplasma gondii, an apicomplexan. Infections with toxoplasmosis are associated with a variety of neuropsychiatric and behavioral conditions. SAG2A is a 22 kDa protein that is mainly found in the surface of tachyzoites.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 8481042151

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 129 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michael S Pryor
Birmingham, US
★★★★★ 5
Good product
Scent: SOLDIER COLLECTION, Size: 5 Ounce (Pack of 6)
Quality product with nice scent! Will buy again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
A
Verified Purchase
Amazon Customer
Phoenix, US
★★★★★ 4
Some didn’t stand out as a good fragrance I liked. They weren’t a bad smell just not what I wanted.
Scent: COLOGNE COLLECTION, Size: 5 Ounce (Pack of 6)
I was reluctant about ordering fragrant soap. I had a bad experience with another popular brand that smelled horrible. This actually had a couple fragrance I liked. The musk is my favorite.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026
M
Verified Purchase
Maria
Dallas, US
★★★★★ 5
They leave ur body smelling good
My husband loves it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
A
Verified Purchase
Alex A.
Phoenix, US
★★★★★ 5
HIGHLY RECOMMENDED. Spells great
I use this product everyday and have used an entire set. They smell great and get you clean, there is a loofa bag included where you put the soap inside and makes scrubbing convenient. Recommend if you want to feel clean and smell really good.. this is the set you can use. I know the ladies like it a lot. I get compliments all the time. One lady told me "You smell like money"... LOL.. true story.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2025
N
Verified Purchase
Nicolas
Dallas, US
★★★★★ 4
Great scent, but leaves a film on my skin.
I was expecting bars of soap with more of a peppermint/eucalyptus fragrance and I just could not relate those fragrances to what the soap actually smells like. The Viking Revolution soap doesn't smell bad per se, and actually for me is rather fragrance neutral like you might find with the more sterile hospital and clinic type soaps. The lather factor for the Viking Revolution soap is mild to moderate in our hard water. It doesn't overdo lathering up but does lather up enough to let you know it is soap and is rather pleasing when rinsing it off where with some soaps you rinse and rinse and still need to rinse more to get the lather off your skin. I wash my hands and face many times throughout the day and night and so far the Viking Revolution soap has done a great job in leaving me feel a bit more refreshed and clean. I have noticed a bit of moisturizing of my face and hands being much softer after use, so the Viking Revolution soap does seem to come through with that feature. I handle and am around livestock and animals quite often and did notice that the soap seemed to cut through the grime pretty easily. I haven't tried the Viking Revolution as a body wash type soap. The square bars are just about a perfect fit for my hand and are easy to hold onto. I will use one bar for the shower and keep the bar in a drip rack where it has a chance to dry out after use. I do really like the presentation of the soap itself and it's a nice touch that each bar comes individually wrapped and includes a sticker and a small card. A rather attractive package if you are giving it for a gift. I'm more favorable of recommending this soap than not recommending it. The only reason I am giving 4 stars is for the fragrances not really being detectable as peppermint and eucalyptus.I do think I would buy this soap again though, fragrance or not.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2024

recommand products