Human NY-BR-1, His tag
SKU: 24015042741

Human NY-BR-1, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NY-BR-1, His tagProduct Specification Species Human Synonyms ANKRD30A Accession Q9BXX3 Amino Acid Sequence Protein sequence(Q9BXX3, Arg851 Leu928, with C 10*His) RMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKNEQTLRADQMFPSESKQKKVEENSWDSESLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 10. 6kDa Actual: 13 20kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m

Product Specification


Species Human
Synonyms ANKRD30A
Accession Q9BXX3
Amino Acid Sequence Protein sequence(Q9BXX3, Arg851-Leu928, with C-10*His) RMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKNEQTLRADQMFPSESKQKKVEENSWDSESLGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:10.6kDa Actual:13-20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

ANKRD30A has been previously identified as NY-BR-1 or antigen B726P. It was identified based on spontaneous humoural immune responses in breast cancer patients (Jäger et al. 2001, 2002). The protein is regarded as a putative transcription factor, as it contains a bipartite nuclear localization signal motif and a bZIP site (DNA-binding site followed by leucine zipper motif). Additional structural features include five tandem ankyrin repeats, implying a role for ANKRD30A in protein–protein interactions. In view of its highly restricted expression pattern, ANKRD30A may be considered as a breast differentiation antigen that could represent a suitable target for immunotherapy. Indeed, it was found in 80% of breast cancer specimens, while tumours of other histological types were ANKRD30A-negative. It was also identified in normal breast, normal testis, was inconsistent in prostate, and not found in other tissues.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24015042741

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 1165 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Rodney
Houston, US
★★★★★ 5
Dog chew toys
Color: Grilled color
Smaller than expected but dogs liked it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
S
Verified Purchase
Shulamit Saeger
Omaha, US
★★★★★ 3
It ok but a bit small for my golden and I have to supervise him.
Color: Grilled color
I don't recommend. Too big for my small dog. Too small for my big dog. They have similar bones but these just seem odd. ** WELL actually after some time they both will chew on them, especially my golden. Do be careful watch the dog while chewing. My home health care aid thought they were real. they are holding up well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025
K
Verified Purchase
Kati
New York, US
★★★★★ 5
Finally a chew toy my aggressive chewer can’t destroy
Color: Grilled color
I’ve gone through countless “indestructible” dog toys that lasted maybe a day—sometimes only minutes. My dog is an aggressive chewer and treats most toys like a personal challenge. These Fuufome chew toys are the real deal. Right out of the box, you can tell they’re made from tough, high-quality nylon. My dog went to work on them immediately, and days later there’s barely any noticeable wear. No chunks missing, no sharp edges, and no mess on the floor. That alone puts these way above most toys I’ve tried. I also love that they actually keep my dog busy. Instead of getting bored and looking for something else to chew (like furniture), she’ll settle in and happily gnaw on these for a long time. It’s been great for mental stimulation and for redirecting destructive chewing. The fact that you get two durable toys in the pack is a bonus, and they’ve held up exactly as advertised. If you have a large breed or an aggressive chewer and you’re tired of wasting money on toys that don’t last, these are absolutely worth it. Highly recommend—this is one of the few chew toys that has truly lived up to the “indestructible” claim. 🐶💪
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2026
E
Verified Purchase
Ellie
Louisville, US
★★★★★ 5
Great for agressiver chewers
Color: Grilled color
Very resistant
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
K
Verified Purchase
Katie Brewer
West Palm Beach, US
★★★★★ 5
Keeps big dogs entertained
Color: Red
Great toy, we have two Labrador/ German Shepherd mix dogs. Keeps them going. Worth the money easy to just plug in, last a couple days before we have to plug in.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026

recommand products